Skip to main content
Cooking With Anadi
RecipesCollectionsTechniquesFree ResourcesAbout
✦ Join the Kitchen
Sign in
Home / Recipes / Chinese / Easy & Flaky Chinese Scallion Pancakes Recipe

Easy & Flaky Chinese Scallion Pancakes Recipe

Crispy golden Chinese scallion pancakes cut into triangles on a wooden board with a small bowl of red chili sauce.
Easy & Flaky Chinese Scallion Pancakes Recipe
Anadi Misra

By Anadi Misra · Updated Apr 16, 2026 · originally published Sep 6, 2024

Chinese50 min6 pancakesmedium
Crispy golden Chinese scallion pancakes cut into triangles on a wooden board with a small bowl of red chili sauce.
Easy & Flaky Chinese Scallion Pancakes Recipe
Anadi Misra

By Anadi Misra · Updated Apr 16, 2026 · originally published Sep 6, 2024

Chinese50 min6 pancakesmedium
Easy & Flaky Chinese Scallion Pancakes Recipe
Anadi Misra

By Anadi Misra · Updated Apr 16, 2026 · originally published Sep 6, 2024

Chinese50 min6 pancakesmedium

About this recipe

Crispy, flaky Chinese scallion pancakes made easy at home. This classic recipe delivers golden layers packed with savory green onion flavor — perfect as a breakfast or side dish.

↓ Jump to Recipe
Leave a review

This post may contain affiliate links. Read our disclosure policy

Watch the recipe

Cooking With Anadi

12K subscribers · golden layers of oil and scallion, flaky and soft

Subscribe

Watch the full method on YouTube →

Are you looking for an amazing new bread experience? This Flaky Chinese Scallion Pancakes recipe was a staple appetizer at one of the restaurants I used to work at, and I’ve always wanted to make them myself! Who knew that they would be so easy to make? With only a handful of ingredients and a little bit of hands-on work, you can make your new favorite flatbread! While these Chinese pancakes appear to be simple, they’re nothing short of aromatic and flavorful thanks to the chewy bread and aromatic green onions.

If China is a destination unseen for you, then this Chinese Scallion Pancakes recipe is definitely unique to explore more of Chinese cooking! I encourage you to try these out as part of your Live to Cook one-month challenge! You can get started for free today by signing up to my free email newsletter, plus all of my latest recipes will be delivered right to your inbox!

To follow along with the entire process from making the dough to perfecting the layers and cooking this scallion pancakes recipe, be sure to watch the video! If you’re not already, please subscribe to my YouTube channel, and be sure to press the bell button to be notified when all of my video recipes are live! Let’s get cooking!

Chinese scallion pancakes stacked on a wooden board with a small bowl of red dipping sauce.

What Is This Chinese Scallion Pancakes Recipe?

Scallion Pancakes, named Cong You Bing, are a Chinese savory flatbread. They remind me of the Indian Laccha Paratha because they are soft, thin, and flaky, with lots of layers. They are a popular street food item in China and are one of the most famous types of Asian pancakes. While a modern favorite, they actually are thousands of years old. The “Cong” in the name refers to the Song Dynasty (960 to 1279), which is the theoretical period in time when these pancakes originated.

This scallion pancakes recipe is made with all-purpose flour, sesame oil and green onions, seasoned with Chinese 5 spice. You prepare your dough, roll it out, and then pan-fry to a crispy and flaky perfection. They are really simply made but they pack in so much flavor!

Crispy Chinese scallion pancakes served on a wooden board with a small bowl of red dipping sauce.
How Do I Keep the Scallion Pancakes Soft?▼
  • Make sure you use hot water while kneading bring the dough together as this will help to knead a softer dough and hence a softer pancake.
  • Additionally, after you have a rough dough, covering the dough tightly with plastic wrap will help keep any moisture within the dough and prevent evaporation.
  • Try not to overwork the dough since that will make the pancakes chewy. Rest time is also key to ensure the gluten in relaxed which promotes a softer final texture.
  • Using moderate heat and oil work together to help cook pancakes that are golden brown outside, have puffed sufficiently from the gentle heat. The oil also helps maintain a soft yet crispy texture.
  • Once the pancakes are ready, make sure to cover with a damp kitchen towel to prevent the breads from hardening up.
How Do You Get Perfect Layers in This Scallion Pancakes Recipe?▼

The key really is to have a fairly regular rectangular shape when you roll out the kneaded dough with a thin layer of oil brushed on top and evenly scattered ingredients for the stuffing. When you roll the dough, you need to ensure you don’t roll it too tightly or loosely and you have the rolled up dough, seam side down before portioning further.

This will help to get evenly spiralized and layer dough portions that can be rolled out to form the pancakes.

Chinese scallion pancakes cut into triangles on a wooden board with chili dipping sauce.

Equipment Needed for This Chinese Flaky Bread Recipe

  • Chef’s knife
  • Cutting board
  • Measuring spoons
  • Measuring cups
  • Salt crock
  • Rolling pin
  • Bench scraper
  • Mixing bowl
  • Fish spatula or silicone spatula
  • Cast iron pan
  • Basting brush
  • Wire rack
Chinese scallion pancakes on a wooden board with a small bowl of dipping sauce.

Ingredients to Make This Chinese Pancakes Recipe

All ingredients and their quantities for this Chinese scallion pancakes recipe are listed in the FULL PRINTABLE recipe card, which you can find by scrolling to the bottom of this post or by pressing the “Jump to Recipe” button. You can also save the recipe for later, and you can use the recipe card to scale the ingredient quantities based on how many Scallion Pancakes you’re looking to make without having to do any ratio calculations!

Ingredients for Chinese scallion pancakes: flour, water, chopped scallions, soy sauce, brown sugar, salt, oil, and sesame oil in small bowls.
  • All purpose flour
  • Water
  • Vegetable oil
  • Green onions
  • Sesame oil
  • Chinese 5-spice
  • Salt

How to Make This Easy Chinese Pancake Recipe

Add the all purpose flour into a large bowl and then add the hot water. Start to mix either with a pair of chopsticks or with your hands until you get a loose ball, with no dried bits of flour. Add more water or flour to reach this consistency. Cover the dough with plastic wrap and let it rest for 15 minutes.

Ingredients for Chinese scallion pancakes: flour in a bowl, chopped scallions, soy sauce, salt, and oil.
Ingredients for Chinese scallion pancakes: flour in bowl, scallions, soy sauce, ginger, salt, and oil
Flour and hot water being mixed in a glass bowl with chopsticks, surrounded by small bowls of scallion, soy sauce, ginger, and oil.
Mixing flour and hot water with chopsticks in a glass bowl to form shaggy dough for scallion pancakes
Hand mixing flour and hot water dough in a glass bowl with chopsticks
Hands mixing flour and hot water dough in a glass bowl with chopsticks for scallion pancakes.
Shaggy dough ball in a floured bowl with ingredient bowls in background for Chinese scallion pancakes.
Hand holding a smooth, oiled dough ball for Chinese scallion pancakes with ingredients blurred in background.

Apply vegetable oil on your work surface and unwrap the dough. Coat the dough with vegetable oil and begin kneading the dough by hand or by using a stand mixer. Knead until you get a smooth, elastic dough. Let the dough rest for 5 minutes.

After the dough has rested, roll out the entire dough ball into a large, thin rectangular shape.

Hand kneading oiled dough for scallion pancakes on dark work surface with sesame oil and chopped scallions nearby.
Hands kneading and stretching thin dough on oiled dark surface with bowls of oil and seasonings nearby.
Hand kneading oiled dough ball on floured work surface with oil and seasoning bowls nearby
Hands stretching and flattening a thin sheet of dough on an oiled dark surface with bowls of oil and seasonings nearby.
Hand holding a round ball of white dough for Chinese scallion pancakes.
Hands kneading and shaping a thin, oval piece of dough on an oiled dark surface for scallion pancakes.
Hands rolling out a thin rectangular sheet of dough for Chinese scallion pancakes on an oiled work surface.
Hand stretching thin, rectangular sheet of dough on oiled gray work surface with ingredient bowls nearby.

Brush the dough with sesame oil, sprinkle Chinese 5-spice evenly and then sprinkle on the chopped scallions. Then, start to roll the dough into a spiral from the longer edge of the rectangular dough. The roll does not need to be too tight, once you have rolled it, place it seam side down.

Hand brushing sesame oil onto rolled-out dough for scallion pancakes on a gray work surface.
Flat dough circle sprinkled with Chinese 5-spice on a gray work surface with condiment bowls nearby.
Unbaked scallion pancake dough topped with Chinese 5-spice and chopped green onions on a dark work surface.
Hands holding a wooden mortar bowl with salt, with scallion pancakes visible in the background.
Hand rolling up dough with scallions and spices into a spiral for Chinese scallion pancakes.
Rolled spiral dough for scallion pancakes viewed from the end, showing the layered circular pattern.

Portion out the spiraled dough into 6 equal portions for medium sized pancakes or 4 equal portions for large, thicker pancakes.

A rolled portion of Chinese scallion pancake dough shaped into a spiral, placed on a dark surface.
Spiral-shaped scallion pancake dough portions held in hand, showing the rolled dough with visible green scallions.
Hand holding a portioned scallion pancake dough spiral showing green scallions inside the rolled dough.
Hand flattening a portion of scallion pancake dough spiral on a dark work surface.
Hand flattening a portion of scallion pancake dough spiral on a gray work surface with other shaped portions nearby.
Unbaked scallion pancake portions coiled spiral-side up, garnished with chopped green onions and black pepper on dark surface.

Place each portion spiral side down and flatten using a rolling pin into a thin disk.

Hand flattening a spiral dough portion with a wooden rolling pin into a thin disk.
Hand flattening spiral dough into a thin disk with a rolling pin for scallion pancakes.
Cooked Chinese scallion pancake on a dark plate, garnished with sliced green onions and black pepper.

Heat a cast iron or non-stick pan on medium heat. Once the pan is hot, brush oil on the pan and then lay the pancake disk on the pan. Cover with a lid and cook for a few minutes. Once the first side becomes golden brown, flip the pancake, cover and cook the other side. Once each side is flaky, golden brown and crispy, set the pancake over a wire rack to cool down. Repeat this step for the remaining portions.

Pink cast iron pan with scallion pancake cooking on medium heat, covered with lid, oil glistening on surface.
Scallion pancake cooking in a pink cast iron skillet with lid, showing the flattened dough with green onions visible on top.
Flaky scallion pancake cooking in a red cast iron pan with lid, showing the dough puffing up while frying.
Hand flipping a scallion pancake on a dark skillet with a spatula during cooking.
Chinese scallion pancake cooking in a red cast iron skillet, showing golden brown edges and green scallions visible on the surface.
Hand flipping a golden-brown scallion pancake in a non-stick skillet using a spatula.
Hand using a slotted spatula to flip a scallion pancake cooking in a cast iron skillet.
Golden scallion pancake cooking in a cast iron pan, garnished with green onions and black pepper.
Cooked scallion pancakes with golden-brown spots on a dark griddle, showing flaky layers and green scallion pieces throughout.

To serve, cut the pancakes into triangles and serve fresh and hot.

Three cooked scallion pancakes on a wooden board with a small bowl of red sauce.
Cooked scallion pancake being cut into a triangle with a knife on a wooden cutting board
Cooked scallion pancake being cut into triangles with a knife on a wooden cutting board.
Hand holding a triangle of flaky scallion pancake with green onions visible, with more pieces on a wooden board.

Variations of This Flaky Scallion Pancakes Recipe

This version is vegetarian and vegan, with green onion being the highlight of the filling. However, if you wanted to, you could add in some cheese, such as a combination of mozzarella and cheddar to get the flavor and gooeyness. If you eat meat, you could try a beef or poultry filling, such as ground beef or chicken, flank steak, or shredded chicken from poached chicken.

Can You Make Crispy Scallion Pancakes Recipe in Advance?▼

For sure you can! While your Asian Pancakes will be most delicious fresh right off the pan, they will be just fine if you want to make them in advance just to have them conveniently ready for you when you’re hungry or if you’ve made extra!

Golden, flaky Chinese scallion pancakes sliced into wedges on a wooden board with chili dipping sauce.

How to Store Scallion Pancakes

In the Fridge

Simply place your cooked pancakes in an airtight container. You can keep them in the fridge for 3 to 4 days. This is because your dough will start to get hard if left in the fridge too long, so the less amount of time you keep them in the fridge, the better they’ll taste reheated.

Cooked scallion pancakes cut into triangles on a wooden board with a small bowl of red dipping sauce.

In the Freezer

You can keep your Scallion Pancakes in a freezer-safe container or in large Ziploc bags. You can keep them in the freezer for up to 4 months, because longer than this runs the risk of them getting freezer burnt. When you’re ready to enjoy your Scallion Pancakes, there’s no need to defrost them in the fridge overnight - you can reheat them directly from frozen as I’ll describe in the next section. They’ll just take a bit longer to reheat compared to as if you were reheating from the fridge.

How to Reheat Scallion Pancakes▼

The best way to reheat Scallion Pancakes, either from the fridge or the freezer, is on a pan over the stove on medium-low heat. This will ensure that the Chinese pancakes do not get soggy and maintain their flavor and texture, in addition to the delicious crispiness!

How to Serve This Chinese Savory Pancake Recipe

From my restaurant experience, Scallion Pancakes are served as an appetizer. I’ve personally had these as a snack when I was recording the recipe! However, I’ve read that in China, it can also be enjoyed as a savory breakfast! Whatever time of day you make it, in my opinion you can enjoy them with a nice dipping sauce, such as soy sauce or chili garlic sauce.

If enjoying these Chinese Pancakes as an appetizer, here are some mains that you can pair with them!

  • Chinese Egg Fried Rice
  • Chicken Hakka Noodles
  • Indo-Chinese Drums of Heaven
  • Asian Fusion Chicken Tacos

Why This Is a Hot Water Dough — and Not a Batter

The first thing to be clear about is that this is a dough, not a batter. If you have made a Korean pajeon you may be expecting to stir something pourable together in a small bowl; that is a different dish entirely. Traditional Chinese scallion pancakes are built from 2 cups of all purpose flour and 2/3 cup of hot water, which is roughly 250 grams of flour if you prefer to weigh. Pour the hot water in and mix with chopsticks or your hands until you have a loose ball with no dry bits of flour left, adding a little more water or flour to get there.

The hot water is the whole trick. A cold water dough — the same flour brought together with cool water — develops far more gluten and fights you when you try to roll it thin, which is why it is the right choice for noodles and the wrong one here. Hot water partly cooks the starch and relaxes the gluten, so the dough rolls out tissue-thin without springing back and the finished pancake stays tender rather than chewy. Cover the loose ball and let it rest at room temperature for 15 minutes before you touch it again.

After the rest, oil your work surface and your hands with vegetable oil and knead — by hand, or in a stand mixer on low speed — until you have a smooth ball with an elastic feel to it. Let that rest another 5 minutes. Neither rest is optional; they are what let the gluten settle so the rolling goes easily.

Rolling the Coil: From Rectangle to Snail to Flaky Layers

Roll the whole dough ball out into one large, thin rectangle. Brush the surface with sesame oil — 2 tablespoons across the sheet — then sprinkle the five-spice powder evenly and scatter over 2 finely chopped green onion stalks. I use both the white part and the green part; the white brings a sharper onion note and the green stays bright and grassy through the frying.

Now roll the rectangle up from its longer edge into a cylinder, like a jelly roll. Do not roll it tight — a slightly loose coil traps more air between the turns, and those turns are the flaky texture you are after. Set the cylinder seam side down, then cut it into pieces of dough: 6 portions for medium pancakes or 4 for larger, thicker ones.

Take each piece and stand it on its cut face so you are looking down at the spiral, then coil it in on itself into a snail shape and press it flat with a rolling pin into a thin disk. Rolling it from the coil rather than from a flat scrap is what stacks the oiled layers on top of each other. Roll each one to whatever diameter suits your pan — the recipe does not fix a size, and a pancake that fits comfortably with a little room around it will cook far more evenly than one crammed edge to edge.

Pan-Frying, Dipping Sauces and What to Do With Leftovers

Heat a cast iron or nonstick skillet on medium heat. Not medium-high heat — this is the single place people go wrong. Too hot and the outside colors before the interior layers have had a chance to steam apart, and you get a pancake that looks right and is dense inside. Brush the hot pan with oil, lay the disk down, cover with a lid, and give it a few minutes. When the first side is golden brown, flip it, cover again, and cook the second side. When both sides are flaky, golden and crisp, move it to a wire rack rather than a plate so the underside does not steam itself soft. Vegetable oil is what I use; peanut oil or canola work identically. Many traditional versions in Chinese restaurants use lard or another animal fat for extra richness, which is worth knowing if you are chasing that flavor — my version stays free of it, which also keeps the pancakes vegan.

Cut them into triangles and serve hot with a dipping sauce in a small bowl. A tablespoon soy sauce with a drizzle of chili oil and a little rice vinegar is my default; the chili garlic sauce I mention above is just as good. They are an appetizer in most Chinese restaurants and a street-food staple in Shanghai, but a green onion pancake alongside a bowl of one of my soups makes a full lunch, and adding a protein such as shredded chicken turns it into dinner.

For leftovers, cooked pancakes keep in the fridge in an airtight container for 3 to 4 days. Reheat them in a dry skillet over medium heat for a minute or two per side, or spread them on a baking sheet in a 350°F oven — do not use the microwave, which turns every crisp layer limp. You can also freeze an uncooked scallion pancake if you would rather cook them to order: stack the raw disks with parchment between them, freeze flat, and fry them straight from frozen over slightly lower heat so the middle catches up with the outside.

Other Tasty Stuffed Bread Recipes

  • Palak Paratha - Spinach Parathas
  • Mini Broccoli Cheese Paratha
  • Paneer Paratha
  • Pyaaz Paratha
  • Aloo Paratha

Let me know what you think of this recipe in the comments! If you’ve tried this recipe, be sure to post it on social media and tag it with #cookingwithanadi and mention me @cooking.with.anadi. Thank you!

Recipe by Anadi Misra

Easy & Flaky Chinese Scallion Pancakes Recipe

Crispy, flaky Chinese scallion pancakes made easy at home. This classic recipe delivers golden layers packed with savory green onion flavor — perfect as a breakfast or side dish.

Stovetop

Rate this recipe ✦

Leave a review
Saved to your collection
··
·
·

20 min

Prep

15 min

Cook

15 min

Rest

50 min

Total

6

pancakes

medium

Level

Ingredients

··
·
·

Ingredients

Tap any quantity to scale

  • (250 g) all purpose flourShop →
  • (160 ml) hot water
  • vegetable oil(as needed)Shop →
  • green onion stalks(finely chopped)
  • (30 ml) sesame oilShop →
  • Chinese 5-spiceShop →
  • salt(to taste)Shop →

Instructions

  1. 1

    Add all-purpose flour into a large bowl and then add the hot water. Start to mix either with a pair of chopsticks or with your hands until you get a loose ball, with no dried bits of flour. Add more water or flour to reach this consistency. Cover the dough with plastic wrap and let it rest for 15 minutes.

    Add all-purpose flour into a large bowl and then add the hot water. Start to mix either with a pair of chopsticks or with your hands until you get a loose ball, with no dried bits of flour. Add more water or flour to reach this consistency. Cover the dough with plastic wrap and let it rest for 15 minutes.

  2. 2

    Apply vegetable oil on your work surface and unwrap the dough. Coat the dough with vegetable oil and begin kneading the dough by hand or by using a stand mixer. Knead until you get a smooth, elastic dough. Let the dough rest for 5 minutes.

    Apply vegetable oil on your work surface and unwrap the dough. Coat the dough with vegetable oil and begin kneading the dough by hand or by using a stand mixer. Knead until you get a smooth, elastic dough. Let the dough rest for 5 minutes.

  3. 3

    After the dough has rested, roll out the entire dough ball into a large, thin rectangular shape. Brush the dough with sesame oil, sprinkle Chinese five-spice evenly and then sprinkle on the chopped scallions.

    After the dough has rested, roll out the entire dough ball into a large, thin rectangular shape. Brush the dough with sesame oil, sprinkle Chinese five-spice evenly and then sprinkle on the chopped scallions.

  4. 4

    Then, start to roll the dough into a spiral from the longer edge of the rectangular dough. The roll does not need to be too tight, once you have rolled it, place it seam side down.

    Then, start to roll the dough into a spiral from the longer edge of the rectangular dough. The roll does not need to be too tight, once you have rolled it, place it seam side down.

  5. 5

    Portion out the spiraled dough into 6 equal portions for medium sized pancakes or 4 equal portions for large, thicker pancakes. Place each portion spiral side down and flatten using a rolling pin into a thin disk.

    Portion out the spiraled dough into 6 equal portions for medium sized pancakes or 4 equal portions for large, thicker pancakes. Place each portion spiral side down and flatten using a rolling pin into a thin disk.

  6. 6

    Heat a cast iron or nonstick pan on medium heat. Once the pan is hot, brush oil on the pan and then lay the pancake disk on the pan. Cover with a lid and cook for a few minutes. Once the first side becomes golden brown, flip the pancake, cover and cook the other side. Once each side is flaky, golden brown and crispy, set the pancake over a wire rack to cool down. Repeat this step for the remaining portions.

    Heat a cast iron or nonstick pan on medium heat. Once the pan is hot, brush oil on the pan and then lay the pancake disk on the pan. Cover with a lid and cook for a few minutes. Once the first side becomes golden brown, flip the pancake, cover and cook the other side. Once each side is flaky, golden brown and crispy, set the pancake over a wire rack to cool down. Repeat this step for the remaining portions.

  7. 7

    To serve, cut the pancakes into triangles and serve fresh and hot.

    To serve, cut the pancakes into triangles and serve fresh and hot.

This section contains affiliate links. As an Amazon Associate I earn from qualifying purchases — at no extra cost to you.

Recommended Tools & Ingredients

Chef’s knife

Check on Amazon →

Cutting board

Check on Amazon →

Prepworks by Progressive Magnetic Measuring Spoons, Stainless Steel - Set of 5

Check on Amazon →

Pyrex Glass Measuring Cup Set (3-Piece, Microwave and Oven Safe),Clear

Check on Amazon →

Salt crock

Check on Amazon →

Rolling pin

Check on Amazon →

Bench scraper

Check on Amazon →

Mixing bowl

Check on Amazon →

MIU France Large Stainless Steel Slotted Turner, 3 by 11-Inch

Check on Amazon →

Flexible spatula

Check on Amazon →

Cast iron pan

Check on Amazon →

Basting brush

Check on Amazon →

Cooling rack

Check on Amazon →

Flour

Check on Amazon →

Vegetable oil

Check on Amazon →

Sesame oil

Check on Amazon →

Chinese 5-spice

Check on Amazon →

airtight container

Check on Amazon →

freezer-safe Ziploc bag

Check on Amazon →

Soy sauce

Check on Amazon →

Chilli garlic sauce

Check on Amazon →

Share This Recipe

Did you make this recipe? Tag @cooking.with.anadi on Instagram and hashtag it #cookingwithanadi

Anadi Misra, signed

Tested & written in Anadi’s kitchen

Recipe history

  • April 16, 2026 — Reworked and refreshed for the 2026 relaunch — new photography, restructured and standardized ingredients & instructions.

Free weekly newsletter

Cook something new every week

One tested recipe and a real weeknight tip from my kitchen.

40,000 home cooks a month cook from this site. Get one tested recipe a week from it, plus the weeknight tip that makes it work.

No spam. Unsubscribe anytime.


Filed under

bread recipesasianchinesechinese pancakeschinese scallion pancakessavoury breakfastshot breakfastsbreakfastsides & starterschinese green onion pancakeschinese pancakes recipechinese green onions pancakeshow to make scallion pancakeshow to make chinese pancakesvegetarianveganegg-lesshalaldairy-free

You might also like

Stack of chocolate coffee pancakes topped with whipped cream and chocolate drizzle on a white plate.
American

Indulge in These Delicious Chocolate Coffee Pancakes

Wake up to rich, fluffy chocolate coffee pancakes bursting with cafe mocha flavor. An easy breakfast recipe that feels indulgent without the fuss. Perfect for sweet mornings at home.

30 minMedium6 pancakes
Stack of four cinnamon pancakes topped with chocolate and vanilla cream cheese frosting and crushed cookies.
American

Yin & Yang Cookie Pancakes with Cream Cheese Glaze

Yin & Yang Cookie Pancakes layered with white and dark chocolate, finished with a luscious cream cheese glaze. The best pancake recipe for a stunning, indulgent breakfast everyone will love.

40 minHard6 pancakes
Stack of four fluffy pancakes topped with blueberries and raspberries on a white plate with decorative blue leaf pattern.
American

Fluffy Lemon Blueberry Raspberry Pancakes Recipe

Fluffy, wholesome Lemon Blueberry Raspberry Pancakes bursting with fresh berry flavor. Made with whole wheat flour and a zesty lemon kick, these healthy pancakes make the perfect sweet breakfast treat.

20 minEasy6 pancakes
Stack of four fluffy pancakes layered with whipped cream and strawberries, topped with whipped cream and fresh berries.
American

Indulge in These Heavenly Strawberry Shortcake Pancakes

Fluffy, fruity, and utterly irresistible — these Strawberry Shortcake Pancakes are the best way to start your morning with a healthy, delicious twist on a classic treat.

35 minMedium6 pancakes
Stack of chocolate pancakes topped with shredded coconut and white chocolate chips on a white plate.
American

Easy Coconut Milk Chocolate Pancakes Recipe

Fluffy, rich, and indulgent, these coconut milk chocolate pancakes are the best way to start your day. Easy to make and packed with flavor, this recipe will become your new breakfast favorite.

20 minEasy6 pancakes
Stacked pancakes topped with banana slices, berries, and whipped cream, surrounded by raspberries and blueberries on a white plate.
American

Healthy and Easy Berry Explosion Pancakes Recipe

Fluffy, healthy Berry Explosion Pancakes packed with fresh fruit and banana. Easy to make and absolutely delicious, this is the best berry pancake recipe for a wholesome breakfast everyone will love.

25 minEasy6 pancakes

Comments

No comments yet — be the first to share your thoughts!

Leave a review

Be the first to share how it went — your note helps other cooks (and earns the recipe its stars).

Made it? Add a rating (optional)
1000 left

Follow Along

@cooking.with.anadi

Follow
Twelve spices go into Nigerian curry powder and not one of them is chilli!
People assume it's the hot jar, but that’s no

Free guide

Desserts That Don't Flop

The oven settings, chill times and doneness cues that decide it.

If yours comes out rubbery this is almost always why, and the fix takes just TWO minutes! Master getting crispy skin air
Get this the wrong way round and the breast is dry before the thighs are anywhere near done. Learn what to do instead in
It isn't the temperature and it isn't your machine. It's a two minute job before the bird goes in the air fryer, and I e
I had never brined a chicken at home before this one. Was it worth it? Find out! Master making the most delicious whole

Tag your makes with #cookingwithanadi